Lineage for d3pnab_ (3pna B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405743Species Cow (Bos taurus) [TaxId:9913] [346265] (3 PDB entries)
  8. 2405745Domain d3pnab_: 3pna B: [344986]
    automated match to d4z07e_
    complexed with cmp, gol

Details for d3pnab_

PDB Entry: 3pna (more details), 1.5 Å

PDB Description: Crystal Structure of cAMP bound (91-244)RIa Subunit of cAMP-dependent Protein Kinase
PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d3pnab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnab_ b.82.3.0 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
syvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgdeg
dnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrdsy
rrilm

SCOPe Domain Coordinates for d3pnab_:

Click to download the PDB-style file with coordinates for d3pnab_.
(The format of our PDB-style files is described here.)

Timeline for d3pnab_:

  • d3pnab_ is new in SCOPe 2.07-stable