SCOPe 2.08: Domain d3pfib1: 3pfi B:23-255

Lineage for d3pfib1 (3pfi B:23-255)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189931] (3 PDB entries)

8. Domain d3pfib1: 3pfi B:23-255 [344982]
   Other proteins in same PDB: d3pfia2, d3pfib2
   automated match to d6blba1
   protein/DNA complex; complexed with adp

Details for d3pfib1

PDB Entry: 3pfi, 2.7 Å

PDB Description: 2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate

PDB Compounds: (B:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d3pfib1:

Sequence, based on SEQRES records:

>d3pfib1 c.37.1.0 (B:23-255) automated matches {Campylobacter jejuni [TaxId: 192222]}
snfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsanikt
taapmieksgdlaailtnlsegdilfideihrlspaieevlypamedyrldiiigsgpaa
qtikidlpkftligattragmlsnplrdrfgmqfrlefykdselalilqkaalklnktce
ekaaleiakrsrstprialrllkrvrdfadvndeeiitekranealnslgvne

Sequence, based on observed residues (ATOM records):

>d3pfib1 c.37.1.0 (B:23-255) automated matches {Campylobacter jejuni [TaxId: 192222]}
snfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsanikt
taapmieksgdlaailtnlsegdilfideihrlspaieevlypamedypkftligattra
gmlsnplrdrfgmqfrlefykdselalilqkaalklnktceekaaleiakrsrstprial
rllkrvrdfadvndeeiitekranealnslgvne

Timeline for d3pfib1:

• d3pfib1 first appeared in SCOPe 2.07