Lineage for d1qj3b_ (1qj3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131773Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (2 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 2131779Species Escherichia coli [TaxId:562] [53439] (11 PDB entries)
  8. 2131801Domain d1qj3b_: 1qj3 B: [34498]
    complexed with kap, na, plp

Details for d1qj3b_

PDB Entry: 1qj3 (more details), 2.7 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid
PDB Compounds: (B:) 7,8-diaminopelargonic acid synthase

SCOPe Domain Sequences for d1qj3b_:

Sequence, based on SEQRES records: (download)

>d1qj3b_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffc

Sequence, based on observed residues (ATOM records): (download)

>d1qj3b_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnlpenlfapapqsrmewderdm
vgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatgf
grtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnggcfmhgptfmgn
placaaanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetthp
vnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffc

SCOPe Domain Coordinates for d1qj3b_:

Click to download the PDB-style file with coordinates for d1qj3b_.
(The format of our PDB-style files is described here.)

Timeline for d1qj3b_: