Lineage for d3ogja_ (3ogj A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405748Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2405770Domain d3ogja_: 3ogj A: [344976]
    automated match to d4z07e_
    complexed with cmp, po4

Details for d3ogja_

PDB Entry: 3ogj (more details), 2.75 Å

PDB Description: Crystal structure of partial apo (92-227) of cGMP-dependent protein kinase
PDB Compounds: (A:) PRKG1 protein

SCOPe Domain Sequences for d3ogja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogja_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
fqtimmrt

SCOPe Domain Coordinates for d3ogja_:

Click to download the PDB-style file with coordinates for d3ogja_.
(The format of our PDB-style files is described here.)

Timeline for d3ogja_:

  • d3ogja_ is new in SCOPe 2.07-stable