SCOPe 2.08: Domain d3nrqa_: 3nrq A:

Lineage for d3nrqa_ (3nrq A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries)

8. Domain d3nrqa_: 3nrq A: [344970]
   automated match to d5i0ya_
   complexed with cu

Details for d3nrqa_

PDB Entry: 3nrq, 1.7 Å

PDB Description: Crystal structure of copper-reconstituted FetP from uropathogenic Escherichia coli strain F11

PDB Compounds: (A:) Periplasmic protein-probably involved in high-affinity Fe2+ transport

SCOPe Domain Sequences for d3nrqa_:

Sequence; same for both SEQRES and ATOM records:

>d3nrqa_ b.1.33.0 (A:) automated matches {Escherichia coli [TaxId: 340197]}
keypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgage
wipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppskag
mhrhtdsetgvgrwwkpfdvsyefkyvgln

Timeline for d3nrqa_:

• d3nrqa_ first appeared in SCOPe 2.07