Lineage for d1qj3a_ (1qj3 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26419Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (11 proteins)
  6. Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species)
  7. Species Escherichia coli [TaxId:562] [53439] (3 PDB entries)
  8. 26440Domain d1qj3a_: 1qj3 A: [34497]

Details for d1qj3a_

PDB Entry: 1qj3 (more details), 2.7 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid

SCOP Domain Sequences for d1qj3a_:

Sequence, based on SEQRES records: (download)

>d1qj3a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffc

Sequence, based on observed residues (ATOM records): (download)

>d1qj3a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnlpenlfapapqsrmgewderd
mvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatg
fgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnggcfmhgptfmg
nplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetth
pvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffc

SCOP Domain Coordinates for d1qj3a_:

Click to download the PDB-style file with coordinates for d1qj3a_.
(The format of our PDB-style files is described here.)

Timeline for d1qj3a_: