| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
| Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
| Protein automated matches [310872] (3 species) not a true protein |
| Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries) |
| Domain d3nrpd1: 3nrp D:3-152 [344968] Other proteins in same PDB: d3nrpa2, d3nrpb2, d3nrpc2, d3nrpd2 automated match to d5i0ya_ |
PDB Entry: 3nrp (more details), 1.6 Å
SCOPe Domain Sequences for d3nrpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nrpd1 b.1.33.0 (D:3-152) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgl
Timeline for d3nrpd1: