SCOPe 2.08: Domain d3nrpa1: 3nrp A:3-153

Lineage for d3nrpa1 (3nrp A:3-153)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:340197] [329434] (4 PDB entries)

8. Domain d3nrpa1: 3nrp A:3-153 [344962]
   Other proteins in same PDB: d3nrpa2, d3nrpb2, d3nrpc2, d3nrpd2
   automated match to d5i0ya_

Details for d3nrpa1

PDB Entry: 3nrp, 1.6 Å

PDB Description: Crystal structure of 'as isolated' uropathogenic E. coli strain F11 FetP recombinantly expressed in the periplasm of E. coli BL21(DE3)

PDB Compounds: (A:) Periplasmic protein-probably involved in high-affinity Fe2+ transport

SCOPe Domain Sequences for d3nrpa1:

Sequence; same for both SEQRES and ATOM records:

>d3nrpa1 b.1.33.0 (A:3-153) automated matches {Escherichia coli [TaxId: 340197]}
fkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgag
ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
gmhrhtdsetgvgrwwkpfdvsyefkyvgln

Timeline for d3nrpa1:

• d3nrpa1 first appeared in SCOPe 2.07