SCOPe 2.08: Domain d3nfgc_: 3nfg C:

Lineage for d3nfgc_ (3nfg C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.65: triple barrel [50915] (1 superfamily)
   dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8

4. Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families)

5. Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins)
   Homology with TFIIF discussed in PubMed 20797630

6. Protein RNA polymerase I subunit A49, interaction domain [346058] (2 species)
   N-terminal part of Pfam PF06870

7. Species Candida glabrata [TaxId:5478] [346253] (2 PDB entries)

8. Domain d3nfgc_: 3nfg C: [344932]
   Other proteins in same PDB: d3nfgb1, d3nfgb2, d3nfgd1, d3nfgd2, d3nfgf1, d3nfgf2, d3nfgh1, d3nfgh2, d3nfgj1, d3nfgj2, d3nfgl1, d3nfgl2, d3nfgn1, d3nfgn2, d3nfgp_
   automated match to d3nffa_
   protein/RNA complex

Details for d3nfgc_

PDB Entry: 3nfg, 2.51 Å

PDB Description: crystal structure of dimerization module of rna polymerase i subcomplex a49/a34.5

PDB Compounds: (C:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d3nfgc_:

Sequence; same for both SEQRES and ATOM records:

>d3nfgc_ b.65.1.2 (C:) RNA polymerase I subunit A49, interaction domain {Candida glabrata [TaxId: 5478]}
rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
ttktnqymvglydkqsgkinlyrapvvtskivskf

Timeline for d3nfgc_:

• d3nfgc_ first appeared in SCOPe 2.07