Lineage for d1qj5a_ (1qj5 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183637Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 183638Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 183961Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (12 proteins)
  6. 183984Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (1 species)
  7. 183985Species Escherichia coli [TaxId:562] [53439] (3 PDB entries)
  8. 183986Domain d1qj5a_: 1qj5 A: [34493]

Details for d1qj5a_

PDB Entry: 1qj5 (more details), 1.8 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase

SCOP Domain Sequences for d1qj5a_:

Sequence, based on SEQRES records: (download)

>d1qj5a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
vqdetffcq

Sequence, based on observed residues (ATOM records): (download)

>d1qj5a_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli}
mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
rmgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil
liadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea
gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv
lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav
qdetffcq

SCOP Domain Coordinates for d1qj5a_:

Click to download the PDB-style file with coordinates for d1qj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qj5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qj5b_