Lineage for d1djea_ (1dje A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866757Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1866973Protein PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) [53436] (1 species)
  7. 1866974Species Escherichia coli [TaxId:562] [53437] (3 PDB entries)
  8. 1866976Domain d1djea_: 1dje A: [34491]
    complexed with plp, so4

Details for d1djea_

PDB Entry: 1dje (more details), 1.71 Å

PDB Description: crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase
PDB Compounds: (A:) 8-amino-7-oxonanoate synthase

SCOPe Domain Sequences for d1djea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djea_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]}
swqekinaaldargaadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtgirpptvpagiarlr
ltltaahemqdidrllevlhgng

SCOPe Domain Coordinates for d1djea_:

Click to download the PDB-style file with coordinates for d1djea_.
(The format of our PDB-style files is described here.)

Timeline for d1djea_: