![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
![]() | Protein MM_2955 [346103] (1 species) |
![]() | Species Methanosarcina mazei [TaxId:2209] [346378] (3 PDB entries) |
![]() | Domain d3liab_: 3lia B: [344909] complexed with btb, so4 |
PDB Entry: 3lia (more details), 1.99 Å
SCOPe Domain Sequences for d3liab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3liab_ d.110.6.4 (B:) MM_2955 {Methanosarcina mazei [TaxId: 2209]} klayeksiemagnyanqfdaqmeanqaiartlactmaeygsqdreeamsiikrilnenpq ligvylgyepdafdgrdknyinapghdstgrfvpycnkingpviieplvhydssdyyqlp kttgkdtltepyfyegifmvsydspifkngefagiagvdvpleyvddvassirtfdtgya fmvsntgiflshptqknwigekslsdfdveeiknaasdiregigghveikdpitgktvim fyepvktgdfsfvlvvpkeemla
Timeline for d3liab_: