Lineage for d3kx2b2 (3kx2 B:271-454)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870793Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43, C-terminal domain [419075] (1 species)
  7. 2870794Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [419569] (2 PDB entries)
  8. 2870796Domain d3kx2b2: 3kx2 B:271-454 [344902]
    Other proteins in same PDB: d3kx2a1, d3kx2a3, d3kx2a4, d3kx2a5, d3kx2b1, d3kx2b3, d3kx2b4, d3kx2b5
    automated match to d3kx2a2
    protein/RNA complex; complexed with adp, mg

Details for d3kx2b2

PDB Entry: 3kx2 (more details), 2.2 Å

PDB Description: crystal structure of prp43p in complex with adp
PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d3kx2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kx2b2 c.37.1.19 (B:271-454) Pre-mRNA splicing factor DEAH RNA helicase Prp43, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
typvelyytpefqrdyldsairtvlqihateeagdillfltgedeiedavrkislegdql
vreegcgplsvyplygslpphqqqrifepapeshngrpgrkvvistniaetsltidgivy
vvdpgfskqkvynprirvesllvspiskasaqqragragrtrpgkcfrlyteeafqkeli
eqsy

SCOPe Domain Coordinates for d3kx2b2:

Click to download the PDB-style file with coordinates for d3kx2b2.
(The format of our PDB-style files is described here.)

Timeline for d3kx2b2: