Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43, C-terminal domain [419075] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [419569] (2 PDB entries) |
Domain d3kx2b2: 3kx2 B:271-454 [344902] Other proteins in same PDB: d3kx2a1, d3kx2a3, d3kx2a4, d3kx2a5, d3kx2b1, d3kx2b3, d3kx2b4, d3kx2b5 automated match to d3kx2a2 protein/RNA complex; complexed with adp, mg |
PDB Entry: 3kx2 (more details), 2.2 Å
SCOPe Domain Sequences for d3kx2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kx2b2 c.37.1.19 (B:271-454) Pre-mRNA splicing factor DEAH RNA helicase Prp43, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} typvelyytpefqrdyldsairtvlqihateeagdillfltgedeiedavrkislegdql vreegcgplsvyplygslpphqqqrifepapeshngrpgrkvvistniaetsltidgivy vvdpgfskqkvynprirvesllvspiskasaqqragragrtrpgkcfrlyteeafqkeli eqsy
Timeline for d3kx2b2: