Lineage for d3kx2a4 (3kx2 A:521-634)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739248Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 2739249Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) (S)
  5. 2739258Family a.289.1.3: Helicase 'ratchet' domain [345959] (1 protein)
    Pfam PF04408; follows the extended AAA-ATPase and winged-helix domains
  6. 2739259Protein Pre-mRNA splicing factor DEAH RNA helicase Prp43 [346045] (1 species)
  7. 2739260Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346216] (2 PDB entries)
  8. 2739261Domain d3kx2a4: 3kx2 A:521-634 [344899]
    Other proteins in same PDB: d3kx2a1, d3kx2a2, d3kx2a3, d3kx2a5, d3kx2b1, d3kx2b2, d3kx2b3, d3kx2b5
    protein/RNA complex; complexed with adp, mg

Details for d3kx2a4

PDB Entry: 3kx2 (more details), 2.2 Å

PDB Description: crystal structure of prp43p in complex with adp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d3kx2a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kx2a4 a.289.1.3 (A:521-634) Pre-mRNA splicing factor DEAH RNA helicase Prp43 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pldpmlavmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhi
tllnvyhafksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlel

SCOPe Domain Coordinates for d3kx2a4:

Click to download the PDB-style file with coordinates for d3kx2a4.
(The format of our PDB-style files is described here.)

Timeline for d3kx2a4: