Lineage for d1b9ia_ (1b9i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896028Protein 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) [53434] (1 species)
  7. 2896029Species Amycolatopsis mediterranei [TaxId:33910] [53435] (2 PDB entries)
  8. 2896031Domain d1b9ia_: 1b9i A: [34489]
    complexed with pxg

Details for d1b9ia_

PDB Entry: 1b9i (more details), 2 Å

PDB Description: crystal structure of 3-amino-5-hydroxybenzoic acid (ahba) synthase
PDB Compounds: (A:) protein (3-amino-5-hydroxybenzoic acid synthase)

SCOPe Domain Sequences for d1b9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ia_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]}
kapefpawpqyddaernglvraleqgqwwrmggdevnsferefaahhgaahalavtngth
alelalqvmgvgpgtevivpaftfisssqaaqrlgavtvpvdvdaatynldpeavaaavt
prtkvimpvhmaglmadmdalakisadtgvpllqdaahahgarwqgkrvgeldsiatfsf
qngklmtageggavvfpdgetekyetaflrhscgrprddrryfhkiagsnmrlnefsasv
lraqlarldeqiavrderwtllsrllgaidgvvpqggdvradrnshymamfripglteer
rnalvdrlveaglpafaafraiyrtdafwelgapdesvdaiarrcpntdaissdcvwlhh
rvllagepelhataeiiadavgra

SCOPe Domain Coordinates for d1b9ia_:

Click to download the PDB-style file with coordinates for d1b9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1b9ia_: