Lineage for d3kjkc_ (3kjk C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958975Species Neisseria meningitidis [TaxId:491] [346368] (2 PDB entries)
  8. 2958990Domain d3kjkc_: 3kjk C: [344886]
    automated match to d5hp7a_

Details for d3kjkc_

PDB Entry: 3kjk (more details), 2.29 Å

PDB Description: Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis (monoclinic crystal form)
PDB Compounds: (C:) NMB1025 protein

SCOPe Domain Sequences for d3kjkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjkc_ d.79.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
mdiryfgttpryseavgangliflsgmvpengetaaeqtadvlaqidrwlaecgsdkahv
ldaviylrdmgdyaemngvwdawvaagrtparacvearlarpewrveikitavkrd

SCOPe Domain Coordinates for d3kjkc_:

Click to download the PDB-style file with coordinates for d3kjkc_.
(The format of our PDB-style files is described here.)

Timeline for d3kjkc_: