Lineage for d3kjjf1 (3kjj F:1-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2958975Species Neisseria meningitidis [TaxId:491] [346368] (2 PDB entries)
  8. 2958981Domain d3kjjf1: 3kjj F:1-116 [344873]
    Other proteins in same PDB: d3kjja2, d3kjjb2, d3kjjc2, d3kjjd2, d3kjje2, d3kjjf2, d3kjjh2, d3kjjj2, d3kjjk2
    automated match to d5hp7a_
    complexed with gol

Details for d3kjjf1

PDB Entry: 3kjj (more details), 1.9 Å

PDB Description: Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis (hexagonal crystal form)
PDB Compounds: (F:) NMB1025 protein

SCOPe Domain Sequences for d3kjjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjjf1 d.79.1.0 (F:1-116) automated matches {Neisseria meningitidis [TaxId: 491]}
mdiryfgttpryseavgangliflsgmvpengetaaeqtadvlaqidrwlaecgsdkahv
ldaviylrdmgdyaemngvwdawvaagrtparacvearlarpewrveikitavkrd

SCOPe Domain Coordinates for d3kjjf1:

Click to download the PDB-style file with coordinates for d3kjjf1.
(The format of our PDB-style files is described here.)

Timeline for d3kjjf1: