SCOPe 2.08: Domain d3kjjc1: 3kjj C:1-117

Lineage for d3kjjc1 (3kjj C:1-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (24 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [346368] (2 PDB entries)

8. Domain d3kjjc1: 3kjj C:1-117 [344867]
   Other proteins in same PDB: d3kjja2, d3kjjb2, d3kjjc2, d3kjjd2, d3kjje2, d3kjjf2, d3kjjh2, d3kjjj2, d3kjjk2
   automated match to d5hp7a_
   complexed with gol

Details for d3kjjc1

PDB Entry: 3kjj, 1.9 Å

PDB Description: Crystal structure of NMB1025, a member of YjgF protein family, from Neisseria meningitidis (hexagonal crystal form)

PDB Compounds: (C:) NMB1025 protein

SCOPe Domain Sequences for d3kjjc1:

Sequence; same for both SEQRES and ATOM records:

>d3kjjc1 d.79.1.0 (C:1-117) automated matches {Neisseria meningitidis [TaxId: 491]}
mdiryfgttpryseavgangliflsgmvpengetaaeqtadvlaqidrwlaecgsdkahv
ldaviylrdmgdyaemngvwdawvaagrtparacvearlarpewrveikitavkrda

Timeline for d3kjjc1:

• d3kjjc1 first appeared in SCOPe 2.07