| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
| Protein automated matches [190935] (24 species) not a true protein |
| Species Neisseria meningitidis [TaxId:491] [346368] (2 PDB entries) |
| Domain d3kjjc1: 3kjj C:1-117 [344867] Other proteins in same PDB: d3kjja2, d3kjjb2, d3kjjc2, d3kjjd2, d3kjje2, d3kjjf2, d3kjjh2, d3kjjj2, d3kjjk2 automated match to d5hp7a_ complexed with gol |
PDB Entry: 3kjj (more details), 1.9 Å
SCOPe Domain Sequences for d3kjjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kjjc1 d.79.1.0 (C:1-117) automated matches {Neisseria meningitidis [TaxId: 491]}
mdiryfgttpryseavgangliflsgmvpengetaaeqtadvlaqidrwlaecgsdkahv
ldaviylrdmgdyaemngvwdawvaagrtparacvearlarpewrveikitavkrda
Timeline for d3kjjc1: