Lineage for d3keqa2 (3keq A:84-211)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2432391Species Streptococcus agalactiae [TaxId:216495] [346277] (2 PDB entries)
  8. 2432394Domain d3keqa2: 3keq A:84-211 [344860]
    Other proteins in same PDB: d3keqa1, d3keqb1
    automated match to d1r72f4
    protein/DNA complex; complexed with nad

Details for d3keqa2

PDB Entry: 3keq (more details), 2.4 Å

PDB Description: Crystal structure of a Rex-family transcriptional regulatory protein from Streptococcus agalactiae complexed with NAD+
PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3keqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3keqa2 c.2.1.0 (A:84-211) automated matches {Streptococcus agalactiae [TaxId: 216495]}
ttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvgkttedgipvygistindh
lidsdietailtvpsteaqevadilvkagikgilsfspvhltlpkdiivqyvdltselqt
llyfmnqq

SCOPe Domain Coordinates for d3keqa2:

Click to download the PDB-style file with coordinates for d3keqa2.
(The format of our PDB-style files is described here.)

Timeline for d3keqa2:

  • d3keqa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3keqa1