Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Streptococcus agalactiae [TaxId:216495] [346277] (2 PDB entries) |
Domain d3keoa2: 3keo A:82-212 [344856] Other proteins in same PDB: d3keoa1, d3keob1 automated match to d1r72f4 protein/DNA complex; complexed with cl, mg, nad |
PDB Entry: 3keo (more details), 1.5 Å
SCOPe Domain Sequences for d3keoa2:
Sequence, based on SEQRES records: (download)
>d3keoa2 c.2.1.0 (A:82-212) automated matches {Streptococcus agalactiae [TaxId: 216495]} hsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvgkttedgipvygistin dhlidsdietailtvpsteaqevadilvkagikgilsfspvhltlpkdiivqyvdltsel qtllyfmnqqr
>d3keoa2 c.2.1.0 (A:82-212) automated matches {Streptococcus agalactiae [TaxId: 216495]} hsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvgkttedgipvygistin dhldsdietailtvpsteaqevadilvkagikgilsfspvhltlpkdiivqyvdltselq tllyfmnqqr
Timeline for d3keoa2: