SCOPe 2.07: Domain d3keoa2: 3keo A:82-212

Lineage for d3keoa2 (3keo A:82-212)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:216495] [346277] (2 PDB entries)

8. Domain d3keoa2: 3keo A:82-212 [344856]
   Other proteins in same PDB: d3keoa1, d3keob1
   automated match to d1r72f4
   protein/DNA complex; complexed with cl, mg, nad

Details for d3keoa2

PDB Entry: 3keo, 1.5 Å

PDB Description: crystal structure of a rex-family transcriptional regulatory protein from streptococcus agalactiae complexed with nad+

PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3keoa2:

Sequence, based on SEQRES records:

>d3keoa2 c.2.1.0 (A:82-212) automated matches {Streptococcus agalactiae [TaxId: 216495]}
hsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvgkttedgipvygistin
dhlidsdietailtvpsteaqevadilvkagikgilsfspvhltlpkdiivqyvdltsel
qtllyfmnqqr

Sequence, based on observed residues (ATOM records):

>d3keoa2 c.2.1.0 (A:82-212) automated matches {Streptococcus agalactiae [TaxId: 216495]}
hsttnvmlvgcgnigrallhyrfhdrnkmqismafdldsndlvgkttedgipvygistin
dhldsdietailtvpsteaqevadilvkagikgilsfspvhltlpkdiivqyvdltselq
tllyfmnqqr

Timeline for d3keoa2:

• d3keoa2 is new in SCOPe 2.07-stable
  
• d3keoa2 appears in the current release, SCOPe 2.08