Lineage for d3keoa1 (3keo A:6-81)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307606Species Streptococcus agalactiae [TaxId:216495] [346168] (2 PDB entries)
  8. 2307607Domain d3keoa1: 3keo A:6-81 [344855]
    Other proteins in same PDB: d3keoa2, d3keob2
    automated match to d1r72f3
    protein/DNA complex; complexed with cl, mg, nad

Details for d3keoa1

PDB Entry: 3keo (more details), 1.5 Å

PDB Description: crystal structure of a rex-family transcriptional regulatory protein from streptococcus agalactiae complexed with nad+
PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3keoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3keoa1 a.4.5.0 (A:6-81) automated matches {Streptococcus agalactiae [TaxId: 216495]}
sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg
ydvkklmnffaeilnd

SCOPe Domain Coordinates for d3keoa1:

Click to download the PDB-style file with coordinates for d3keoa1.
(The format of our PDB-style files is described here.)

Timeline for d3keoa1:

  • d3keoa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3keoa2