Lineage for d1dfob_ (1dfo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131911Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2131954Species Escherichia coli [TaxId:562] [53433] (2 PDB entries)
  8. 2131956Domain d1dfob_: 1dfo B: [34481]
    complexed with ffo, plg

Details for d1dfob_

PDB Entry: 1dfo (more details), 2.4 Å

PDB Description: crystal structure at 2.4 angstrom resolution of e. coli serine hydroxymethyltransferase in complex with glycine and 5-formyl tetrahydrofolate
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1dfob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfob_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]}
mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
gkryyggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya

SCOPe Domain Coordinates for d1dfob_:

Click to download the PDB-style file with coordinates for d1dfob_.
(The format of our PDB-style files is described here.)

Timeline for d1dfob_: