Lineage for d3ikvb2 (3ikv B:78-206)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430308Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 protein domains)
    automatically mapped to Pfam PF02629
  6. 2430327Protein automated matches [346067] (1 species)
    not a true protein
  7. 2430328Species Thermus thermophilus [TaxId:262724] [346276] (1 PDB entry)
  8. 2430330Domain d3ikvb2: 3ikv B:78-206 [344790]
    Other proteins in same PDB: d3ikva1, d3ikvb1
    automated match to d1r72a4
    complexed with ca; mutant

Details for d3ikvb2

PDB Entry: 3ikv (more details), 2.4 Å

PDB Description: Crystal structure of a Rex-family repressor R90D mutant from Thermus aquaticus
PDB Compounds: (B:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3ikvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikvb2 c.2.1.12 (B:78-206) automated matches {Thermus thermophilus [TaxId: 262724]}
nrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpkwr

SCOPe Domain Coordinates for d3ikvb2:

Click to download the PDB-style file with coordinates for d3ikvb2.
(The format of our PDB-style files is described here.)

Timeline for d3ikvb2:

  • d3ikvb2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3ikvb1