Lineage for d3ihya1 (3ihy A:532-871)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979552Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2979556Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2979557Species Human (Homo sapiens) [TaxId:9606] [56174] (78 PDB entries)
  8. 2979622Domain d3ihya1: 3ihy A:532-871 [344784]
    Other proteins in same PDB: d3ihya2

Details for d3ihya1

PDB Entry: 3ihy (more details), 2.8 Å

PDB Description: human pik3c3 crystal structure
PDB Compounds: (A:) Phosphatidylinositol 3-kinase catalytic subunit type 3

SCOPe Domain Sequences for d3ihya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihya1 d.144.1.4 (A:532-871) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dksvrvmrsllaaqqtfvdrlvhlmkavqresgnrkkknerlqallgdnekmnlsdveli
plplepqvkirgiipetatlfksalmpaqlffktedggkypvifkhgddlrqdqlilqii
slmdkllrkenldlkltpykvlatstkhgfmqfiqsvpvaevldtegsiqnffrkyapse
ngpngisaevmdtyvkscagycvityilgvgdrhldnllltktgklfhidfgyilgrdpk
plpppmklnkemvegmggtqseqyqefrkqcytaflhlrrysnlilnlfslmvdanipdi
alepdktvkkvqdkfrldlsdeeavhymqslidesvhalf

SCOPe Domain Coordinates for d3ihya1:

Click to download the PDB-style file with coordinates for d3ihya1.
(The format of our PDB-style files is described here.)

Timeline for d3ihya1: