Lineage for d3hbxf_ (3hbx F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2473128Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)
  8. 2473154Domain d3hbxf_: 3hbx F: [344781]
    automated match to d5gp4c_

Details for d3hbxf_

PDB Entry: 3hbx (more details), 2.67 Å

PDB Description: crystal structure of gad1 from arabidopsis thaliana
PDB Compounds: (F:) Glutamate decarboxylase 1

SCOPe Domain Sequences for d3hbxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbxf_ c.67.1.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
rlvidiekvmreldelp

SCOPe Domain Coordinates for d3hbxf_:

Click to download the PDB-style file with coordinates for d3hbxf_.
(The format of our PDB-style files is described here.)

Timeline for d3hbxf_:

  • d3hbxf_ is new in SCOPe 2.07-stable