Lineage for d1ejia_ (1eji A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131911Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2131970Species Mouse (Mus musculus) [TaxId:10090] [53431] (1 PDB entry)
  8. 2131971Domain d1ejia_: 1eji A: [34475]
    complexed with plg, thf

Details for d1ejia_

PDB Entry: 1eji (more details), 2.9 Å

PDB Description: recombinant serine hydroxymethyltransferase (mouse)
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1ejia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejia_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Mouse (Mus musculus) [TaxId: 10090]}
madrdatlwashekmlsqplkdsdaevysiikkesnrqrvgleliasenfasravlealg
sslnnkysegypgqryyggtefidelemlcqkralqayhldpqcwgvnvqpysgspanfa
vytalvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvypetgyinydql
eenaslfhpkliiagtscysrnldyarlrkiaddngaylmadmahisglvaagvvpspfe
hchvvtttthktlrgcragmifyrkgvrsvdpktgketyyeleslinsavfpglqggphn
haiagvavalkqamttefkiyqlqvlancralsdaltelgykivtggsdnhlilmdlrsk
gtdggraekvleacsiacnkntcpgdksalrpsglrlgtpaltsrglleedfqkvahfih
rgieltlqiqshmatkatlkefkeklagdekiqsavatlreevenfasnfslpglpdf

SCOPe Domain Coordinates for d1ejia_:

Click to download the PDB-style file with coordinates for d1ejia_.
(The format of our PDB-style files is described here.)

Timeline for d1ejia_: