SCOPe 2.08: Domain d3gufb_: 3guf B:

Lineage for d3gufb_ (3guf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (10 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:92829] [346222] (3 PDB entries)

8. Domain d3gufb_: 3guf B: [344731]
   automated match to d5j7na_

Details for d3gufb_

PDB Entry: 3guf, 2.28 Å

PDB Description: Crystal Structure of the hspA from Xanthomonas axonopodis

PDB Compounds: (B:) Low molecular weight heat shock protein

SCOPe Domain Sequences for d3gufb_:

Sequence; same for both SEQRES and ATOM records:

>d3gufb_ b.15.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
aqwvprvdikeevnhfvlyadlpgidpsqievqmdkgilsirgerksessteterfsrie
rrygsfhrrfalpdsadadgitaagrngvleiripkrpaa

Timeline for d3gufb_:

• d3gufb_ first appeared in SCOPe 2.07