Lineage for d3gt6b_ (3gt6 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773987Species Xanthomonas axonopodis [TaxId:92829] [346222] (3 PDB entries)
  8. 2773991Domain d3gt6b_: 3gt6 B: [344729]
    automated match to d5j7na_

Details for d3gt6b_

PDB Entry: 3gt6 (more details), 2.15 Å

PDB Description: Crystal Structure of the hspA from Xanthomonas axonopodis
PDB Compounds: (B:) Low molecular weight heat shock protein

SCOPe Domain Sequences for d3gt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gt6b_ b.15.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
aqwvprvdikeevnhfvlyadlpgidpsqievqmdkgilsirgerksessteterfsrie
rrygsfhrrfalpdsadadgitaagrngvleiripkrpaa

SCOPe Domain Coordinates for d3gt6b_:

Click to download the PDB-style file with coordinates for d3gt6b_.
(The format of our PDB-style files is described here.)

Timeline for d3gt6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gt6a_