| Class b: All beta proteins [48724] (180 folds) |
| Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
| Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
| Protein automated matches [191181] (10 species) not a true protein |
| Species Xanthomonas axonopodis [TaxId:92829] [346222] (3 PDB entries) |
| Domain d3glab_: 3gla B: [344727] automated match to d5j7na_ complexed with po4 |
PDB Entry: 3gla (more details), 1.64 Å
SCOPe Domain Sequences for d3glab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glab_ b.15.1.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
qwvprvdikeevnhfvlyadlpgidpsqievqmdkgilsirgerksessteterfsrier
rygsfhrrfalpdsadadgitaagrngvleiripkrpaa
Timeline for d3glab_: