Lineage for d3g6dl2 (3g6d L:109-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749548Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2749552Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2749594Domain d3g6dl2: 3g6d L:109-210 [344725]
    Other proteins in same PDB: d3g6da_, d3g6dh1, d3g6dh2, d3g6dl1
    complexed with so4

Details for d3g6dl2

PDB Entry: 3g6d (more details), 3.2 Å

PDB Description: Crystal structure of the complex between CNTO607 Fab and IL-13
PDB Compounds: (L:) CNTO607 Fab Light chain

SCOPe Domain Sequences for d3g6dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6dl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d3g6dl2:

Click to download the PDB-style file with coordinates for d3g6dl2.
(The format of our PDB-style files is described here.)

Timeline for d3g6dl2: