Lineage for d3g6da_ (3g6d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2315782Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2315783Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2315881Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 2315907Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 2315908Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)
  8. 2315917Domain d3g6da_: 3g6d A: [344721]
    Other proteins in same PDB: d3g6dh1, d3g6dh2, d3g6dl1, d3g6dl2
    complexed with so4

Details for d3g6da_

PDB Entry: 3g6d (more details), 3.2 Å

PDB Description: Crystal structure of the complex between CNTO607 Fab and IL-13
PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d3g6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6da_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
vppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiekt
qrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfre

SCOPe Domain Coordinates for d3g6da_:

Click to download the PDB-style file with coordinates for d3g6da_.
(The format of our PDB-style files is described here.)

Timeline for d3g6da_:

  • d3g6da_ is new in SCOPe 2.07-stable