Lineage for d1bjob_ (1bjo B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) 
Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (12 proteins) 
Protein Phosphoserine aminotransferase, PSAT [53426] (2 species) Species Escherichia coli [TaxId:562] [53428] (2 PDB entries) 
Domain d1bjob_: 1bjo B: [34472]
Details for d1bjob_
PDB Entry: 1bjo (more details), 2.8 Å
PDB Description: the structure of phosphoserine aminotransferase from e. coli in complex with alpha-methyl-l-glutamate
SCOP Domain Sequences for d1bjob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjob_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Escherichia coli}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg
SCOP Domain Coordinates for d1bjob_:
Click to download the PDB-style file with coordinates for d1bjob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjob_:
- d1bjob_ first appeared (with stable ids) in SCOP 1.55
- d1bjob_ appears in SCOP 1.57
- d1bjob_ appears in SCOP 1.61
- d1bjob_ appears in the current release, SCOPe 2.08
View in 3D
