| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
| Protein automated matches [190646] (77 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [270918] (2 PDB entries) |
| Domain d3g1wa_: 3g1w A: [344719] automated match to d5hsga_ |
PDB Entry: 3g1w (more details), 2.02 Å
SCOPe Domain Sequences for d3g1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1wa_ c.93.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
etymmitfqsgmdywkrclkgfedaaqalnvtveyrgaaqydiqeqitvleqaiaknpag
iaisaidpveltdtinkavdagipivlfdsgapdshahsflgtnnynagmnaaykmaell
dgegevavitlpnqlnhqerttgfketleaefpaieviavedgrgdslhsrrvahqlled
ypnlagifateanggvgvgdavrlesrageiqiisfdtdkgtldlvdegiisatlaqgtw
nmgywsltylfhlhhgltepqilqtreeaplplyvdtgitivtdenvdyyy
Timeline for d3g1wa_: