SCOPe 2.08: Domain d3g1wa_: 3g1w A:

Lineage for d3g1wa_ (3g1w A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [270918] (2 PDB entries)

8. Domain d3g1wa_: 3g1w A: [344719]
   automated match to d5hsga_

Details for d3g1wa_

PDB Entry: 3g1w, 2.02 Å

PDB Description: crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans

PDB Compounds: (A:) Sugar ABC transporter

SCOPe Domain Sequences for d3g1wa_:

Sequence; same for both SEQRES and ATOM records:

>d3g1wa_ c.93.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
etymmitfqsgmdywkrclkgfedaaqalnvtveyrgaaqydiqeqitvleqaiaknpag
iaisaidpveltdtinkavdagipivlfdsgapdshahsflgtnnynagmnaaykmaell
dgegevavitlpnqlnhqerttgfketleaefpaieviavedgrgdslhsrrvahqlled
ypnlagifateanggvgvgdavrlesrageiqiisfdtdkgtldlvdegiisatlaqgtw
nmgywsltylfhlhhgltepqilqtreeaplplyvdtgitivtdenvdyyy

Timeline for d3g1wa_:

• d3g1wa_ first appeared in SCOPe 2.07