Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) has extra strand located between strands 1 and 2 |
Family c.72.2.0: automated matches [254328] (1 protein) not a true family |
Protein automated matches [254749] (4 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [346327] (1 PDB entry) |
Domain d3eagb2: 3eag B:93-323 [344708] Other proteins in same PDB: d3eaga1, d3eaga3, d3eagb1, d3eagb3 automated match to d5vvwa2 complexed with gol |
PDB Entry: 3eag (more details), 2.55 Å
SCOPe Domain Sequences for d3eagb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eagb2 c.72.2.0 (B:93-323) automated matches {Neisseria meningitidis [TaxId: 122586]} gpqwlsenvlhhhwvlgvagthgktttasmlawvleyaglapgfliggvpenfgvsarlp qtprqdpnsqspffvieadeydtaffdkrskfvhyrprtavlnnlefdhadifadlgaiq tqfhylvrtvpseglivcngrqqslqdtldkgcwtpvekfgtehgwqageanadgsfdvl ldgktagrvkwdlmgrhnrmnalaviaaarhvgvdiqtacealgafknvkr
Timeline for d3eagb2: