Lineage for d3eagb1 (3eag B:1-92)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2433922Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2433923Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2433946Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2433947Protein automated matches [254548] (7 species)
    not a true protein
  7. 2433962Species Neisseria meningitidis [TaxId:122586] [346278] (1 PDB entry)
  8. 2433964Domain d3eagb1: 3eag B:1-92 [344707]
    Other proteins in same PDB: d3eaga2, d3eaga3, d3eagb2, d3eagb3
    automated match to d5vvwa1
    complexed with gol

Details for d3eagb1

PDB Entry: 3eag (more details), 2.55 Å

PDB Description: The crystal structure of UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (MPL) from Neisseria meningitides
PDB Compounds: (B:) UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase

SCOPe Domain Sequences for d3eagb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eagb1 c.5.1.0 (B:1-92) automated matches {Neisseria meningitidis [TaxId: 122586]}
mkhihiigiggtfmgglaaiakeagfevsgcdakmyppmstqlealgidvyegfdaaqld
efkadvyvignvakrgmdvveailnlglpyis

SCOPe Domain Coordinates for d3eagb1:

Click to download the PDB-style file with coordinates for d3eagb1.
(The format of our PDB-style files is described here.)

Timeline for d3eagb1:

  • d3eagb1 is new in SCOPe 2.07-stable