SCOPe 2.08: Domain d3eaga2: 3eag A:93-323

Lineage for d3eaga2 (3eag A:93-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.0: automated matches [254328] (1 protein)
   not a true family

6. Protein automated matches [254749] (4 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [346327] (1 PDB entry)

8. Domain d3eaga2: 3eag A:93-323 [344705]
   Other proteins in same PDB: d3eaga1, d3eaga3, d3eagb1, d3eagb3
   automated match to d5vvwa2
   complexed with gol

Details for d3eaga2

PDB Entry: 3eag, 2.55 Å

PDB Description: The crystal structure of UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (MPL) from Neisseria meningitides

PDB Compounds: (A:) UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase

SCOPe Domain Sequences for d3eaga2:

Sequence; same for both SEQRES and ATOM records:

>d3eaga2 c.72.2.0 (A:93-323) automated matches {Neisseria meningitidis [TaxId: 122586]}
gpqwlsenvlhhhwvlgvagthgktttasmlawvleyaglapgfliggvpenfgvsarlp
qtprqdpnsqspffvieadeydtaffdkrskfvhyrprtavlnnlefdhadifadlgaiq
tqfhylvrtvpseglivcngrqqslqdtldkgcwtpvekfgtehgwqageanadgsfdvl
ldgktagrvkwdlmgrhnrmnalaviaaarhvgvdiqtacealgafknvkr

Timeline for d3eaga2:

• d3eaga2 first appeared in SCOPe 2.07