Lineage for d3e6ja_ (3e6j A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435399Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (13 PDB entries)
  8. 2435401Domain d3e6ja_: 3e6j A: [344703]
    automated match to d5wk4e_
    complexed with dr2, gol, so4

Details for d3e6ja_

PDB Entry: 3e6j (more details), 1.67 Å

PDB Description: Crystal Structure of Variable Lymphocyte Receptor (VLR) RBC36 in Complex with H-trisaccharide
PDB Compounds: (A:) Variable lymphocyte receptor diversity region

SCOPe Domain Sequences for d3e6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6ja_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
aacpsqcscsgttvdcrskrhasvpagiptnaqilylhdnqitklepgvfdslinlkely
lgsnqlgalpvgvfdsltqltvldlgtnqltvlpsavfdrlvhlkelfmccnkltelprg
ierlthlthlaldqnqlksiphgafdrlsslthaylfgnpwdcecrdimylrnwvadhts
iamrwdgkavndpdsakcagtntpvravteastspskcp

SCOPe Domain Coordinates for d3e6ja_:

Click to download the PDB-style file with coordinates for d3e6ja_.
(The format of our PDB-style files is described here.)

Timeline for d3e6ja_:

  • d3e6ja_ is new in SCOPe 2.07-stable