SCOPe 2.07: Domain d3chma2: 3chm A:88-164

Lineage for d3chma2 (3chm A:88-164)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
   Pfam PF01399
   some members have long C-terminal tail with helix

6. Protein COP9 signalosome complex subunit 7 (CSN7), C-terminal domain [346013] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346157] (1 PDB entry)

8. Domain d3chma2: 3chm A:88-164 [344700]
   Other proteins in same PDB: d3chma1
   complexed with act, mg

Details for d3chma2

PDB Entry: 3chm, 1.5 Å

PDB Description: Crystal structure of PCI domain from A. thaliana COP9 signalosome subunit 7 (CSN7)

PDB Compounds: (A:) COP9 signalosome complex subunit 7

SCOPe Domain Sequences for d3chma2:

Sequence; same for both SEQRES and ATOM records:

>d3chma2 a.4.5.47 (A:88-164) COP9 signalosome complex subunit 7 (CSN7), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spdqilklkqltvltlaesnkvlpydtlmveldvsnvreledflinecmyagivrgkldq
lkrcfevpfaagrdlrp

Timeline for d3chma2:

• d3chma2 is new in SCOPe 2.07-stable
  
• d3chma2 appears in the current release, SCOPe 2.08