Lineage for d3chma2 (3chm A:88-164)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306772Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 protein domains)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2306782Protein COP9 signalosome complex subunit 7 (CSN7), C-terminal domain [346013] (1 species)
  7. 2306783Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346157] (1 PDB entry)
  8. 2306784Domain d3chma2: 3chm A:88-164 [344700]
    Other proteins in same PDB: d3chma1
    complexed with act, mg

Details for d3chma2

PDB Entry: 3chm (more details), 1.5 Å

PDB Description: Crystal structure of PCI domain from A. thaliana COP9 signalosome subunit 7 (CSN7)
PDB Compounds: (A:) COP9 signalosome complex subunit 7

SCOPe Domain Sequences for d3chma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chma2 a.4.5.47 (A:88-164) COP9 signalosome complex subunit 7 (CSN7), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spdqilklkqltvltlaesnkvlpydtlmveldvsnvreledflinecmyagivrgkldq
lkrcfevpfaagrdlrp

SCOPe Domain Coordinates for d3chma2:

Click to download the PDB-style file with coordinates for d3chma2.
(The format of our PDB-style files is described here.)

Timeline for d3chma2:

  • d3chma2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3chma1