Lineage for d1bjnb_ (1bjn B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131870Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2131901Species Escherichia coli [TaxId:562] [53428] (2 PDB entries)
  8. 2131903Domain d1bjnb_: 1bjn B: [34470]

Details for d1bjnb_

PDB Entry: 1bjn (more details), 2.3 Å

PDB Description: structure of phosphoserine aminotransferase from escherichia coli
PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d1bjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjnb_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg

SCOPe Domain Coordinates for d1bjnb_:

Click to download the PDB-style file with coordinates for d1bjnb_.
(The format of our PDB-style files is described here.)

Timeline for d1bjnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bjna_