Lineage for d3chma1 (3chm A:4-87)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2340010Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418

    this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain
  6. 2340017Protein COP9 signalosome complex subunit 7 (CSN7), N-terminal domain [346032] (1 species)
  7. 2340018Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346194] (1 PDB entry)
  8. 2340019Domain d3chma1: 3chm A:4-87 [344699]
    Other proteins in same PDB: d3chma2
    complexed with act, mg

Details for d3chma1

PDB Entry: 3chm (more details), 1.5 Å

PDB Description: Crystal structure of PCI domain from A. thaliana COP9 signalosome subunit 7 (CSN7)
PDB Compounds: (A:) COP9 signalosome complex subunit 7

SCOPe Domain Sequences for d3chma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chma1 a.118.8.9 (A:4-87) COP9 signalosome complex subunit 7 (CSN7), N-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eqkqaeiidqlvkrastcksealgpliieatshpslfafseilalpnvaqlegttdsvyl
dllrlfahgtwgdykcnatrlphl

SCOPe Domain Coordinates for d3chma1:

Click to download the PDB-style file with coordinates for d3chma1.
(The format of our PDB-style files is described here.)

Timeline for d3chma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3chma2