Lineage for d2xfld_ (2xfl D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551502Species Micromonospora chersina [TaxId:47854] [346354] (2 PDB entries)
  8. 2551510Domain d2xfld_: 2xfl D: [344688]
    automated match to d5v10a_

Details for d2xfld_

PDB Entry: 2xfl (more details), 2.9 Å

PDB Description: induced-fit and allosteric effects upon polyene binding revealed by crystal structures of the dynemicin thioesterase
PDB Compounds: (D:) dyne7

SCOPe Domain Sequences for d2xfld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xfld_ d.38.1.0 (D:) automated matches {Micromonospora chersina [TaxId: 47854]}
dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch
adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg
lepvevpaelrralsryavva

SCOPe Domain Coordinates for d2xfld_:

Click to download the PDB-style file with coordinates for d2xfld_.
(The format of our PDB-style files is described here.)

Timeline for d2xfld_: