![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Micromonospora chersina [TaxId:47854] [346354] (2 PDB entries) |
![]() | Domain d2xfld_: 2xfl D: [344688] automated match to d5v10a_ |
PDB Entry: 2xfl (more details), 2.9 Å
SCOPe Domain Sequences for d2xfld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfld_ d.38.1.0 (D:) automated matches {Micromonospora chersina [TaxId: 47854]} dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg lepvevpaelrralsryavva
Timeline for d2xfld_: