Lineage for d2xflc_ (2xfl C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944447Species Micromonospora chersina [TaxId:47854] [346354] (2 PDB entries)
  8. 2944454Domain d2xflc_: 2xfl C: [344687]
    automated match to d5v10a_

Details for d2xflc_

PDB Entry: 2xfl (more details), 2.9 Å

PDB Description: induced-fit and allosteric effects upon polyene binding revealed by crystal structures of the dynemicin thioesterase
PDB Compounds: (C:) dyne7

SCOPe Domain Sequences for d2xflc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xflc_ d.38.1.0 (C:) automated matches {Micromonospora chersina [TaxId: 47854]}
dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch
adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg
lepvevpaelrralsr

SCOPe Domain Coordinates for d2xflc_:

Click to download the PDB-style file with coordinates for d2xflc_.
(The format of our PDB-style files is described here.)

Timeline for d2xflc_: