Lineage for d2x2nb_ (2x2n B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332313Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (9 PDB entries)
  8. 2332331Domain d2x2nb_: 2x2n B: [344675]
    automated match to d4uhia_
    complexed with hem, x2n

Details for d2x2nb_

PDB Entry: 2x2n (more details), 2.6 Å

PDB Description: X-ray structure of cyp51 from trypanosoma brucei in complex with posaconazole in two different conformations
PDB Compounds: (B:) lanosterol 14-alpha-demethylase

SCOPe Domain Sequences for d2x2nb_:

Sequence, based on SEQRES records: (download)

>d2x2nb_ a.104.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tdppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsrf
flprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhe
vrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessli
paavflpillklplpqsarcheartelqkilseiiiarkaaavnkdsstsdllsgllsav
yrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaq
lnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshh
deeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllr
devpdpdyhtmvvgptasqcrvkyirrk

Sequence, based on observed residues (ATOM records): (download)

>d2x2nb_ a.104.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
tdppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsrf
flprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhe
vrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessli
paavflpillklplpqsarcheartelqkilseiiiarkaaavstsdllsgllsavyrdg
tpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaqlnyn
nvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshhdeea
fpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllrdevp
dpdyhtmvvgptasqcrvkyirrk

SCOPe Domain Coordinates for d2x2nb_:

Click to download the PDB-style file with coordinates for d2x2nb_.
(The format of our PDB-style files is described here.)

Timeline for d2x2nb_:

  • d2x2nb_ is new in SCOPe 2.07-stable