Lineage for d2wuzb_ (2wuz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (19 PDB entries)
  8. 2332297Domain d2wuzb_: 2wuz B: [344669]
    automated match to d4uhia_
    complexed with hem, tpf

Details for d2wuzb_

PDB Entry: 2wuz (more details), 2.35 Å

PDB Description: X-ray structure of CYP51 from Trypanosoma cruzi in complex with fluconazole in alternative conformation
PDB Compounds: (B:) lanosterol 14-alpha-demethylase, putative

SCOPe Domain Sequences for d2wuzb_:

Sequence, based on SEQRES records: (download)

>d2wuzb_ a.104.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
rptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehs
rffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmess
lipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllk
avyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefp
aqlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacsplls
hhdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfql
lrdevpdpdyhtmvvgptlnqclvkytrkkklp

Sequence, based on observed residues (ATOM records): (download)

>d2wuzb_ a.104.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
rptdppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehs
rffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmess
lipaavfmpwllrlplpqsarcrearaelqkilgeiivarekedllggllkavyrdgtrm
slhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvm
dempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpn
prlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpd
yhtmvvgptlnqclvkytrkkklp

SCOPe Domain Coordinates for d2wuzb_:

Click to download the PDB-style file with coordinates for d2wuzb_.
(The format of our PDB-style files is described here.)

Timeline for d2wuzb_:

  • d2wuzb_ is new in SCOPe 2.07-stable