Lineage for d2uvnb_ (2uvn B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331979Species Mycobacterium tuberculosis [TaxId:83332] [226004] (16 PDB entries)
  8. 2331999Domain d2uvnb_: 2uvn B: [344656]
    Other proteins in same PDB: d2uvna2
    automated match to d2wh8a_
    complexed with ecn, f, hem, so4

Details for d2uvnb_

PDB Entry: 2uvn (more details), 3 Å

PDB Description: crystal structure of econazole-bound cyp130 from mycobacterium tuberculosis
PDB Compounds: (B:) cytochrome p450 130

SCOPe Domain Sequences for d2uvnb_:

Sequence, based on SEQRES records: (download)

>d2uvnb_ a.104.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hefqlataetwpnpwpmyralrdhdpvhhvvppqrpeydyyvlsrhadvwsaardhqtfs
saqgltvnygelemiglhdtppmvmqdppvhtefrklvsrgftprqvetveptvrkfvve
rleklrangggdivtelfkplpsmvvahylgvpeedwtqfdgwtqaivaanavdgattga
ldavgsmmayftglierrrtepaddaishlvaagvgadgdtagtlsilaftftmvtggnd
tvtgmlggsmpllhrrpdqrrlllddpegipdaveellrltspvqglartttrdvtigdt
tipagrrvlllygsanrderqygpdaaeldvtrcprniltfshgahhclgaaaarmqcrv
altellarcpdfevaesrivwsggsyvrrplsvpfrvts

Sequence, based on observed residues (ATOM records): (download)

>d2uvnb_ a.104.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hefqlataetwpnpwpmyralrdhdpvhhvvppqrpeydyyvlsrhadvwsaardhqtfs
saqgltvnygelemiglhdtppmvmqdppvhtefrklvsrgftprqvetveptvrkfvve
rleklrangggdivtelfkplpsmvvahylgvpeedwtqfdgwtqaivattgaldavgsm
mayftglierrrtepaddaishlvaagvgadgdtagtlsilaftftmvtggndtvtgmlg
gsmpllhrrpdqrrlllddpegipdaveellrltspvqglartttrdvtigdttipagrr
vlllygsanrderqygpdaaeldvtrcprniltfshgahhclgaaaarmqcrvaltella
rcpdfevaesrivwsggsyvrrplsvpfrvts

SCOPe Domain Coordinates for d2uvnb_:

Click to download the PDB-style file with coordinates for d2uvnb_.
(The format of our PDB-style files is described here.)

Timeline for d2uvnb_:

  • d2uvnb_ is new in SCOPe 2.07-stable