Lineage for d2ptsa1 (2pts A:1-456)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337411Species Escherichia coli [TaxId:562] [346209] (3 PDB entries)
  8. 2337416Domain d2ptsa1: 2pts A:1-456 [344634]
    Other proteins in same PDB: d2ptsa2
    automated match to d3bhga_

Details for d2ptsa1

PDB Entry: 2pts (more details), 2 Å

PDB Description: Crystal structure of wild type Escherichia coli adenylosuccinate lyase
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d2ptsa1:

Sequence, based on SEQRES records: (download)

>d2ptsa1 a.127.1.0 (A:1-456) automated matches {Escherichia coli [TaxId: 562]}
melssltavspvdgrygdkvsalrgifseygllkfrvqvevrwlqklaahaaikevpafa
adaigyldaivasfseedaariktierttnhdvkaveyflkekvaeipelhavsefihfa
ctsedinnlshalmlktardevilpywrqlidglkdlavqyrdipllsrthgqpatpsti
gkemanvayrmerqyrqlnqveilgkingavgnynahiaaypevdwhqfseefvtslgiq
wnpyttqiephdyiaelfdcvarfntilidfdrdvwgyialnhfkqktiageigsstmph
kvnpidfensegnlglsnavlqhlasklpvsrwqrdltdstvlrnlgvgigyaliayqst
lkgvsklevnrdhlldeldhnwevlaepiqtvmrrygiekpyeklkeltrgkrvdaegmk
qfidglalpeeekarlkamtpanyigraitmvdelk

Sequence, based on observed residues (ATOM records): (download)

>d2ptsa1 a.127.1.0 (A:1-456) automated matches {Escherichia coli [TaxId: 562]}
melssltavspvdgrygdkvsalrgifseygllkfrvqvevrwlqklaahaaikevpafa
adaigyldaivasfseedaariktierttnhdvkaveyflkekvaeipelhavsefihfa
ctsedinnlshalmlktardevilpywrqlidglkdlavqyrdipllsrthgqpatpsti
gkemanvayrmerqyrqlnqveilgkingavgnynahiaaypevdwhqfseefvtslgiq
wnpyttqiephdyiaelfdcvarfntilidfdrdvwgyialnhfkqktimphkvnpidfe
nsegnlglsnavlqhlasklpvsrwqrdltdstvlrnlgvgigyaliayqstlkgvskle
vnrdhlldeldhnwevlaepiqtvmrrygiekpyeklkeltrvdaegmkqfidglalpee
ekarlkamtpanyigraitmvdelk

SCOPe Domain Coordinates for d2ptsa1:

Click to download the PDB-style file with coordinates for d2ptsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ptsa1:

  • d2ptsa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2ptsa2