Lineage for d2ptqb1 (2ptq B:1-456)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337411Species Escherichia coli [TaxId:562] [346209] (3 PDB entries)
  8. 2337415Domain d2ptqb1: 2ptq B:1-456 [344628]
    Other proteins in same PDB: d2ptqa2, d2ptqb2
    automated match to d3bhga_
    complexed with amp, fum; mutant

Details for d2ptqb1

PDB Entry: 2ptq (more details), 2 Å

PDB Description: Crystal structure of Escherichia coli adenylosuccinate lyase mutant H171N with bound AMP and fumarate
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d2ptqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptqb1 a.127.1.0 (B:1-456) automated matches {Escherichia coli [TaxId: 562]}
melssltavspvdgrygdkvsalrgifseygllkfrvqvevrwlqklaahaaikevpafa
adaigyldaivasfseedaariktierttnhdvkaveyflkekvaeipelhavsefihfa
ctsedinnlshalmlktardevilpywrqlidglkdlavqyrdipllsrtngqpatpsti
gkemanvayrmerqyrqlnqveilgkingavgnynahiaaypevdwhqfseefvtslgiq
wnpyttqiephdyiaelfdcvarfntilidfdrdvwgyialnhfkqktiageigsstmph
kvnpidfensegnlglsnavlqhlasklpvsrwqrdltdstvlrnlgvgigyaliayqst
lkgvsklevnrdhlldeldhnwevlaepiqtvmrrygiekpyeklkeltrgkrvdaegmk
qfidglalpeeekarlkamtpanyigraitmvdelk

SCOPe Domain Coordinates for d2ptqb1:

Click to download the PDB-style file with coordinates for d2ptqb1.
(The format of our PDB-style files is described here.)

Timeline for d2ptqb1:

  • d2ptqb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2ptqb2