SCOPe 2.08: Domain d2oyaa1: 2oya A:421-518

Lineage for d2oyaa1 (2oya A:421-518)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (3 families)

5. Family d.170.1.0: automated matches [331628] (1 protein)
   not a true family

6. Protein automated matches [331629] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [346392] (5 PDB entries)

8. Domain d2oyaa1: 2oya A:421-518 [344622]
   Other proteins in same PDB: d2oyaa2, d2oyab2
   automated match to d5hrja_
   complexed with so4

Details for d2oyaa1

PDB Entry: 2oya, 1.77 Å

PDB Description: crystal structure analysis of the dimeric form of the srcr domain of mouse marco

PDB Compounds: (A:) Macrophage receptor MARCO

SCOPe Domain Sequences for d2oyaa1:

Sequence; same for both SEQRES and ATOM records:

>d2oyaa1 d.170.1.0 (A:421-518) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qrvrimggtnrgraevyynnewgticdddwdnndatvfcrmlgysrgralssygggsgni
wldnvncrgtenslwdcsknswgnhncvhnedagvecs

Timeline for d2oyaa1:

• d2oyaa1 first appeared in SCOPe 2.07